Adropin (34-76) (hu...

Adropin (34-76) (human, mouse, rat)

Adropin (34-76) (human, mouse, rat)

Min.Order / FOB Price:Get Latest Price

5 Milligram

Negotiable

  • Min.Order :5 Milligram
  • Purity: >98%
  • Payment Terms : T/T

Keywords

Adropin (34-76) CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP H-Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH(Disulfide bond)

Quick Details

  • Appearance:White lyophilised solid
  • Application:Cardiovascular System & Diseases|Diabetes|Obesity Research
  • PackAge:mg/g/kg
  • ProductionCapacity:inquire||
  • Storage:-20°C, avoid light, cool and dry place
  • Transportation:DHL/Fedex

Superiority:

Adropin is a secreted factor involved in energy homeostasis and lipid metabolism. It is encoded by the energy homeostasis associated gene (Enho) and is expressed in liver and brain. In diet-induced obesity (DIO) mice Adropin (34-76) attenuated hepatosteatosis and insulin reistance independently of adiposity or food intake. Additionally, adropin could be a regulator of endothelial function.

Details:

Shanghai Yaxian Chemical Co.,Ltd stands as a highly renowned, technology - driven enterprise with a strong focus on synthetic custom peptides, custom antibodies, and active pharmaceutical ingredients (APIs).

Situated in Jiangsu, our establishment encompasses a 1000 - square - meter plant and office area. Within this space, we house a total of 3 workshops. These workshops are equipped with 2 chemical synthesis lines, which are crucial for the production of a wide range of chemical compounds. Additionally, we have 2 peptide synthesis lines dedicated to the precise creation of custom peptides. Our 1 R&D center serves as the epicenter of innovation, where our team of experts constantly explores new techniques and methodologies.

Our team of professionals boasts over 20 years of in - depth experience in peptide research. This wealth of knowledge, combined with our state - of - the - art peptide synthesis equipment and cutting - edge technology, allows us to offer highly reliable products and services to our global clientele. We are committed to maintaining the highest standards of quality at every stage of production, from raw material procurement to the final delivery of products.

Today, our products and services have reached clients in more than 50 countries and regions across the globe. We have built a solid reputation for our prompt delivery, excellent product quality, and outstanding customer service.

Yaxian is unwaveringly committed to becoming the world's most reliable chemical company. We strive to provide a comprehensive one - stop solution for biochemistry research, covering everything from the synthesis of complex molecules to providing technical support and guidance to our clients. Whether it's a small - scale research project or a large - scale industrial production requirement, Yaxian is the partner you can trust for all your chemical and biochemical needs.

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View