- Min.Order :1 Kilogram
- Purity: 99%
- Payment Terms : L/C,T/T,
Keywords
16961-83-4 ACTH F6H2Si
Quick Details
- Appearance:conform
- Application:intermediate
- PackAge:as per buyers
- ProductionCapacity:1|Metric Ton|Day
- Storage:R.T.
- Transportation:by air/sea
Superiority:
Our company was built in 2009 with an ISO certificate.In the past 5 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.Our main business covers the fields below:
1.Noble Metal Catalysts (Pt.Pd...)
2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)
3.OLED intermediates (Fluorene,Carbazole,Boric acid...)
4.Customs Synthesis
Our advantage:
1. Higest quality and good package
2.Fast delivery
3.Better payment term
4.Fast response to customer within 6 hours
5.Good business credit in Europe ,US ,Japan ,Korea
Anyway ,if you need any chemicals from China ,Henan Tianfu can help you
Details:
| Hexafluorosilicic acid Basic information |
| Product Name: | Hexafluorosilicic acid |
| Synonyms: | SILICOFLUORIC ACID;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN;HYDROGEN HEXAFLUOROSILICATE;HYDROFLUOROSILICIC ACID;HYDROFLUOSILICIC ACID;HYDROSILICOFLUORIC ACID |
| CAS: | 16961-83-4 |
| MF: | F6H2Si |
| MW: | 144.09 |
| EINECS: | 241-034-8 |
| Product Categories: | Inorganics;Acids;Electronic Chemicals;Micro/Nanoelectronics;peptide;Fluoride |
| Mol File: | 16961-83-4.mol |
|
|
|
| Hexafluorosilicic acid Chemical Properties |
| bp | 108-109°C |
| density | 1.22 g/mL at 25 °C |
| refractive index | 1.3500 |
| Fp | 108-109°C |
| storage temp. | −20°C |
| solubility | H2O: 1 mg/mL, clear, colorless |
| Merck | 14,4182 |
| Stability: | Stable in aqueous solution. |
| CAS DataBase Reference | 16961-83-4(CAS DataBase Reference) |
| EPA Substance Registry System | Silicate(2-), hexafluoro-, dihydrogen(16961-83-4) |
| Safety Information |
| Hazard Codes | C |
| Risk Statements | 34-35-20/21/22 |
| Safety Statements | 26-36/37/39-45-27 |
| RIDADR | UN 1778 8/PG 2 |
| WGK Germany | 3 |
| RTECS | VV8225000 |
| F | 8-10 |
| Hazard Note | Corrosive |
| TSCA | Yes |
| HazardClass | 8 |
| PackingGroup | II |
| Hazardous Substances Data | 16961-83-4(Hazardous Substances Data) |
| MSDS Information |
| Provider | Language |
|---|---|
| SigmaAldrich | English |
| ACROS | English |
| ALFA | English |
| Hexafluorosilicic acid Usage And Synthesis |
| Chemical Properties | colourless liquid; often supplied as a colourless solution in water |
| General Description | A colorless fuming liquid with a penetrating pungent odor. Corrosive to metals and tissue. Both the fumes and very short contact with the liquid can cause severe and painful burns. Used in water fluoridation, in hardening cement and ceramics, as a wood preservative. |
| Air & Water Reactions | Fumes in air. Soluble in water with release of heat and corrosive fumes. |
| Reactivity Profile | Hexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. Attacks glass and materials containing silica. Reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). Reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. Can initiate polymerization in certain alkenes. Reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. Flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. Additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give H2S and SO3), dithionites (SO2), and carbonates. Can catalyze (increase the rate of) chemical reactions. Decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas. |
| Health Hazard | Inhalation of vapor produces severe corrosive effect on mucous membrane. Ingestion causes severe burns of mouth and stomach. Contact with liquid or vapor causes severe burns of eyes and skin. |
| Fire Hazard | Special Hazards of Combustion Products: Irritating fumes of hydrogen fluoride may form in fire. |
| Hexafluorosilicic acid Preparation Products And Raw materials |
You Might Also Like
-
Newblue 29911-28-2 DI(PROPYLENE GLYCOL) BUTYL ETHER
CAS NO:29911-28-2
-
Newblue 32435-46-4 BIS(2-METHACRYLOXYETHYL) PHOSPHATE
CAS NO:32435-46-4
-
Newblue CHEM- Offer High Quality 99% Pure O,O'-Bis(2-aminopropyl)polypropyleneglycol 9046-10-0 Global
CAS NO:9046-10-0
-
NewblueCHEM-Sale High Quality Epitalon 307297-39-8 Wholesale Price
CAS NO:307297-39-8
-
High Grade4-Fluoro-1,3-dioxolan-2-one 114435-02-8 Fast Delivery
CAS NO:114435-02-8
-
Newblue CHEM - Supply 10497-05-9 TRIS(TRIMETHYLSILYL) PHOSPHATE In Stock
CAS NO:10497-05-9
Related Searches
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View