Peptide Terlipressi...

Peptide Terlipressin Acetate of high purity peptide
Peptide Terlipressin Acetate of high purity peptide
Peptide Terlipressin Acetate of high purity peptide
Peptide Terlipressin Acetate of high purity peptide
Peptide Terlipressin Acetate of high purity peptide

Peptide Terlipressin Acetate of high purity peptide

Min.Order / FOB Price:Get Latest Price

10 Gram

FOB Price:USD 10.0000 -20.0000

  • Min.Order :10 Gram
  • Purity: ≥98%
  • Payment Terms : L/C,D/A,D/P,T/T,

Keywords

Terlipressin Acetate Terlipressin Acetate Terlipressin Acetate

Quick Details

  • Appearance:White to off white powder
  • Application: Pharmaceutical
  • PackAge:plastic tube/vials
  • ProductionCapacity:1000|Gram|Week
  • Storage:Store in a cool dry place and keep away from direct strong light
  • Transportation:EMS,TNT,DHL

Superiority:

Superiority

1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from our customers. We had Established long friendly relations of cooperation.

2.High quality, best price, firstclass service, high successful delivery rate.

3.We have stock, so we can delivery quickly at the very day when receive the payment.

4.We will never sell, solicit,or give your information to any third parties. All transactions are confidential.Your satisfaction is guaranteed,as long as you have dissatisfaction,we will show our biggest sincerity and patience to solve problems.

5.We have the special way can ship 50 grams to 50kg products at a time. We can offer the melting powder into liquid service.And ship the liquid in the special bottles. According to your request and the quantity what you buy, we have several packaging methods for your choice. safety and quick shipping to you.

6.We can do ,TT and Money Gram wire transfer payment term.

Details:

Lab Supply Pharmaceutical Intermediate Powder Peptide Terlipressin Acetate 14636-12-5

Description
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS:  
Product Categories: Amino Acid Derivatives;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;EndocrinologyandHormones;proteins
Mol File: 52232-67-4.mol

Terlipressin (trade names Teripress by New Medicon Pharma and Glypressin by Ferring Pharmaceuticals) is an analogue of vasopressin used as a vasoactive drug in the management of hypotension. It has been found to be effective when norepinephrine does not help.

Our process:
The quality control process
1)Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.
2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.
3) Producing
a)Each operator must do self-inspection of producs and make the corresponding inspection records.
b)Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.
4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.
Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2.Payment method: ,TT.
3.Service: Best service with after-sales service to all clients.
4.Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.

 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View