143090-92-0 Anakinra (IL-1Ra) Human interleukin-1 receptor antagonist (IL-1Ra)
Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues.
Chemical Name | Human interleukin-1 receptor antagonist; IL-1Ra |
Purity | 98% |
Sequences |
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLG IHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGW FLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Protein average weight | 17257.6 Da |
Protein chemical formula | C759H1186N208O232S10 |
CAS # | 143090-92-0 |
Storage | ≤-20℃ |
Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues.
For research use only. Not for use in humans.
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View