Min.Order / FOB Price:Get Latest Price
0 Metric Ton |
Negotiable |
144409-98-3 Amyloid β-Amyloid (1-40)
Nanjing TGpeptide Biotechnology Co.,Ltd.("TGpeptide" hereafter), who is founded in 2019, located at Jiangbei New Material Industrial Park, is a professional enterprise enageged in researching, developing, manufacturing and sales of peptide, antibody and protein products and their technologies.
Range of Services:
1, Linear peptides: Quantity from mg to kg, up to 180 residues.
2, The range of purity: Crude、Desalted、>70%、>80%、>90%、>95%、>98%、>99%.
3, Peptide modifications: C-terminal modifications, N-terminal modifications, Fluorescence and Dye Labeling Peptides, Cyclic Peptides Synthesis, Phosphopeptides etc.
4, Peptides with different structures: Linear peptides, MAPs, Cyclic peptides etc.
5, Antigen peptides: KLH, BSA, 0VA coupling.
6, Different packages: we can make aliquots according to the demand of customers, and it's free.
107P37 |
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
β-Amyloid (1-40), rat |
C???H???N??O??S |
4233.78 |
144409-98-3 |
Synthetic |
-20 ± 5 °C |
Alzheimer's Disease |
CAS NO:862772-11-0
CAS NO:140430-53-1
CAS NO:730985-86-1
CAS NO:189696-01-3
CAS NO:113711-77-6
CAS NO:25126-32-3
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View