Custom Peptide Synthesis Foxo4 Peptide / Foxo4-Dri / Senolytics From Us Warehouse Safe Shipping

Details:

 

Yinherb FOXO4-D-Retro-Inverso(DRI) Custom peptide Peptide Bulk powder
Name:FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide                        
acetate (salt), Synthetic luteinizing hormone-releasing factor acetate
Appearance :White powder
Purity (HPLC)  >98.0%
Single Impurity(HPLC) :1.0%max
Amino Acid Composition :±10% of theoretical
Peptide Content(N%) :≥80.0% 
Water Content(Karl Fischer): ≤8.0%
Acetate Content(HPIC): ≤12.0%
MS(ESI): Consistent
Mass Balance: 95.0~105.0% 
Bacterial Endotoxins :≤5EU/mg
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

 

 

What is FOXO4-D-Retro-Inverso(DRI) Custom Peptide
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

 

 

 

Custom clearance service:

1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.

 

Delivery Service:

We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!

 

Packing:

Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;

Drum: 10kg, 15kg, 25kg with food grade PE nag inside.

 

 

Delivery:

Shipping Terms
By Express	By Air	By sea
Suitable for ≤ 50kg    Faster 5-7days               High Cost                 Door to Door               Easy Pick Up Goods	Suitable for ≥ 50kg    Fastest: 1-2 days                High Cost                 Airport to Airport       Pick Up Goods by Customer	Suitable for ≥ 500kg    Fast: 15-30 days                Low Cost                 Port to Port            Pick Up Goods by Customer

Payment:

Payment terms	Western Union
	Moneygram
	PayPal
	Wire Transfer
	Bitcoin