Adrenocorticotropin...

Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder
Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder
Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder
Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder
Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder

Adrenocorticotropin/ACTH 1-39, Acethropan Corticotropin Raw Powder

Min.Order / FOB Price:Get Latest Price

1 Gram

Negotiable

  • Min.Order :1 Gram
  • Purity: 99.89%
  • Payment Terms : L/C,D/A,D/P,T/T,,MoneyGram

Keywords

ACTH(1-39) Peptides ACTH(1-39) 12279-41-3

Quick Details

  • Appearance:White fine powder
  • Application:Applicated in body building.
  • PackAge:1kg/foil bag, 25kgs/drum
  • ProductionCapacity:5|Kilogram|Week
  • Storage:Store at room temperature or cooler, in a sealed airtight container, protected from heat, light and humidity.
  • Transportation:We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days

Superiority:

 
Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics, Sarms and Peptides researching and developing, and become the leader manufacturer on all kinds of nootropics powder, we guarantted the every batch quality and give you test report along with order, we always believe "quality is firstly, service is secondly, price is thirdly ", so must build with every customer in an enjoyable business relationship!
 
You are buying = Our Products + Our Service:
1,Quality is our culture ,strict QC/QA systems under GMP factory.
 
2,Fast and safe delivery with secure and discreet shipment.
 
3,With us, your money is in safe as well as your business.It's our promise to you!
 
4,For whatever questions about us or our products you may have, do let us know and you can be assured we reply you in details with 24 hours and to your satisfaction.
 
5,Warmly welcome your visit in our company if available.

 

Details:

 

 

Yinherb Supply 98% pure polypeptide cas 9002-60-2 Adrenocorticotropic Hormone, ACTH 1-39 
Name: ACTH(1-39), Corticotropin
Cas No: N/A
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.

 

What is ACTH 1-39
Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress.

It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed.

ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.

ACTH 1-39 Benifits
Adrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan,ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursorcorticotropin-releasing hormone from the hypothalamus).

Its principal effects are increased production and release of cortisol by the cortex of the adrenal gland. Primary adrenal insufficiency, also calledAddison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism.

 

Other Cosmetic Peptide:

Matrixyl3000
Copper Peptide
Oligopeptide-1
Carnosine
Acetyl Hexapeptide-8
Acetyl Hexapeptide-49
Acetyl Hexapeptide-38
Pentapeptide-18
Pentapeptide-3
Hexapeptide-10
Hexapeptide-9
Palmitoyl Trieptide-1
Palmitoyl Tripeptide-8
Palmitoyl Tripeptide-38

MORE ...... 

 

 

 

 

Custom clearance service:

1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.

 

Delivery Service:

We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!

 

Packing:

Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;

Drum: 10kg, 15kg, 25kg with food grade PE nag inside.

 

 

Delivery:

Shipping Terms
By Express By Air By sea

Suitable for ≤ 50kg   

Faster 5-7days              

High Cost                

Door to Door              

Easy Pick Up Goods

Suitable for ≥ 50kg   

Fastest: 1-2 days               

High Cost                

Airport to Airport      

Pick Up Goods by Customer             

Suitable for ≥ 500kg   

Fast: 15-30 days               

Low Cost                

Port to Port           

Pick Up Goods by Customer


Payment:

Payment terms Western Union
Moneygram
PayPal
Wire Transfer
Bitcoin

 

 
Q1: Can i get some samples 
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments 
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, or Paypal or Escrow(Alibaba).
 
Q3: How to confirm the Product Quality before placing orders 
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ 
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
 
Q5: How about delivery leadtime 
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
 
Q6:Is there a discount 
A:Different quantity has different discount.
 
Q7: How do you treat quality complaint 
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.
 

Related Searches

Confirm to collect the product to my collection?

OKCancel

About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia

Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog

©2008 LookChem.com,License: ICP

NO.:Zhejiang16009103

complaints:service@lookchem.com Desktop View