Yinherb Factory Supplier 98% Pure Polypeptide ACTH 1-39

Details:

 

 

Yinherb Supply 98% pure polypeptide cas 9002-60-2 Adrenocorticotropic Hormone, ACTH 1-39 
Name: ACTH(1-39), Corticotropin
Cas No: N/A
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.

 

What is ACTH 1-39
Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress.

It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed.

ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.

ACTH 1-39 Benifits
Adrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan,ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursorcorticotropin-releasing hormone from the hypothalamus).

Its principal effects are increased production and release of cortisol by the cortex of the adrenal gland. Primary adrenal insufficiency, also calledAddison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism.

 

 

 

Custom clearance service:

1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.

 

Delivery Service:

We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!

 

Packing:

Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;

Drum: 10kg, 15kg, 25kg with food grade PE nag inside.

 

 

Delivery:

Shipping Terms
By Express	By Air	By sea
Suitable for ≤ 50kg    Faster 5-7days               High Cost                 Door to Door               Easy Pick Up Goods	Suitable for ≥ 50kg    Fastest: 1-2 days                High Cost                 Airport to Airport       Pick Up Goods by Customer	Suitable for ≥ 500kg    Fast: 15-30 days                Low Cost                 Port to Port            Pick Up Goods by Customer

Payment:

Payment terms	Western Union
	Moneygram
	PayPal
	Wire Transfer
	Bitcoin