Chemical Name: CRF (HUMAN, RAT)
CAS No.: 86784-80-7
RTECS: GM7925000
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45 g/mol
Storage temp.: -20°C
Product Categories about Human corticotropin-releasing factor (CAS No.:86784-80-7) are Peptide ; CRF receptor and related
The chemical synonymous of Human corticotropin-releasing factor (CAS No.:86784-80-7) are SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 ; SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; Corticotropin releasing factor ; Corticotropin releasing factor (CRF), human, rat ; Corticotropin releasing factor, human ; Corticotropin releasing factor, human and rat ; Corticotropin releasing factor human, rat ; CRF, human and rat
1. | ivn-rat LD50:>1 mg/kg | YACHDS Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241. | ||
2. | ivn-dog LD50:>1 mg/kg | YACHDS Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241. |
Moderately toxic by intravenous route. Experimental reproductive effects. When heated to decomposition it emits toxic vapors of NOx and SOx.
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View