Our Strength: -Flexible: We work in small teams with rapid communication channels. Respond quickly and efficiently to customer and market needs. -Innovative: We are focusing on the development of new products and keep close relationships with
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $1300.0 / 1400.0
Type:Lab/Research institutions
inquiryAs a leading manufacturer and supplier of chemicals in China, DayangChem not only supply popular chemicals, but also DayangChem's R&D center offer custom synthesis services. DayangChem can provide different quantities of custom synthesis ch
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $3.0
Type:Lab/Research institutions
inquiryItems Standard Result Appearance straw yellow powder Complies Assay 99%min
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $1.5 / 4.0
Type:Manufacturers
inquiryWelcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Manufacturers
inquiryProduct name 3-Carboxy-4-nitrophenyl disulfide Synonyms 5,5'-Dithiobis(2-nitrobenzoic acid); 6,6'-Dinitro-3,3'-dithiodibenzoic acid; Bis(3-carboxy-4-nitrophenyl) disulfid
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Other
inquiryHigh purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent Company profile Wuhan Fortuna Chemical Co.,Ltd established in 2006, is a big integrative chemical enterprise being engaged in Pharmaceutical &
Cas:69-78-3
Min.Order:100 Gram
FOB Price: $10.0
Type:Trading Company
inquiryhe company has advanced technology, as well as a large number of excellent R & D team, to provide customers from the grams to one hundred kilograms and tons of high-quality products, competitive prices and quality se T rvice Appearance:White or
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Manufacturers
inquiryThe above product is Ality Chemical's strong item with best price, good quality and fast supply. Ality Chemical has been focusing on the research and production of this field for over 14 years. At the same time, we are always committed to providi
Cas:69-78-3
Min.Order:1
Negotiable
Type:Other
inquiryWe could give you: 1. Best quality in your requirement 2. Competitive price in China market 3. mature Technical support 4. Professional logistic support 5 . Full experience of large numbers containers loading in Chinese sea p
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $1.0 / 1000.0
Type:Manufacturers
inquiryOur main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block
Cas:69-78-3
Min.Order:5 Kiloliter
FOB Price: $1.2 / 5.0
Type:Manufacturers
inquiryWith our good experience, we offer detailed technical support and advice to assist customers. We communicate closely with customers to establish their quality requirements. Consistent Quality Our plant has strict quality control in each manufacturin
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $3.0 / 10.0
Type:Trading Company
inquiry3-Carboxy-4-nitrophenyl disulfide Basic information Product Name: 3-Carboxy-4-nitrophenyl disulfide Synonyms: DTNB;ellmann's reagent;ELLMAN'S REAGENT;ELLMANS' REAGENT;BIS(3-C
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Lab/Research institutions
inquiryWITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $139.0 / 210.0
Type:Trading Company
inquiryName: 5,5-Dithiobis(2-nitrobenzoic acid) Molecular formula:C14H8N2O8S2 Molecular wt:396.34 CAS:69-78-3 Appearance:white-light yellow crystal powder Storage:Store in cool and dry place, away from sun light. Package:25kg Application:used in all kinds
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $1.0
Type:Other
inquiryAppearance:White-light yellow crystal powder Storage:R.T Package:500G/Bottle or at customers requirement. Application:Widely used in biochemical research, it is a sensitive determination reagent for the research and production of biochemical reactio
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $1.0
Type:Lab/Research institutions
inquiry1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Lab/Research institutions
inquiry5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high qu
Cas:69-78-3
Min.Order:1 Gram
Negotiable
Type:Lab/Research institutions
inquiryHello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai
Cas:69-78-3
Min.Order:1 Kilogram
Negotiable
Type:Lab/Research institutions
inquiryHenan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod
Best quality & Attractive price & Professional service; Trial & Pilot & Commercial Hisunny Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality intermediates, specia
Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det
Cas:69-78-3
Min.Order:0 Metric Ton
Negotiable
Type:Lab/Research institutions
inquiryJ&H CHEM R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. J&H CHEM has some Manufacturing base in Jia
Cas:69-78-3
Min.Order:0
Negotiable
Type:Lab/Research institutions
inquiryMassive Chemical is certified with ISO9001 and ISO14001 manufacturer for this product. We will offer all documents as requirement for the materials which includes, Certificate of Analysis, Material Safety Data Sheet, and Method of Analysis and
Cas:69-78-3
Min.Order:1 Gram
FOB Price: $1.0
Type:Lab/Research institutions
inquiryZibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi
Cas:69-78-3
Min.Order:10 Gram
FOB Price: $100.0
Type:Lab/Research institutions
inquiryDtnb,Cas 69-78-3Appearance:powder Storage:Store in a cool dry place and keep away from strong light Package:according to customers' requirements Application:in research Transportation:By air(EMS or EUB or FedEx or TNT ect...) or by sea(FOB or CIF or
Our Advantages Production: Advanced chemical equipment with years of experience Staffs for producing various extract products. Quality Control:A complete set of Testing Professional and Analysis Equipment ensures the Quality Requirements and Specif
Cas:69-78-3
Min.Order:1 Kilogram
FOB Price: $75.0 / 150.0
Type:Trading Company
inquiryProduct Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,
Cas:69-78-3
Min.Order:1 Gram
Negotiable
Type:Lab/Research institutions
inquiryGMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,
Cas:69-78-3
Min.Order:1 Milligram
Negotiable
Type:Trading Company
inquiryHigh quality, competitive price, fast delivery and first-class service we possesses have won the trust and praise of customers. Standard: BP/USP/EP The purity is equal or greater than 99%. As a supplier, we can provide high-quality products. Cle
Cas:69-78-3
Min.Order:1 Metric Ton
Negotiable
Type:Lab/Research institutions
inquiryProduct Name: 5,5′-Dithiobis(2-nitrobenzoic acid) Synonyms: DTNB;ellmann's reagent;ELLMAN'S REAGENT;ELLMANS' REAGENT;BIS(3-CARBOXY-4-NITROPHENYL) DISULFIDE;3-CARBOXY-4-NITROPHENYL DISULFIDE;Ellmsn'sreagent;Bis(3-carboxy-4-
Cas:69-78-3
Min.Order:1 Gram
Negotiable
Type:Lab/Research institutions
inquiryConditions | Yield |
---|---|
With sodium sulfide In water at 50℃; for 2h; pH=> 3.5; | 72.3% |
Conditions | Yield |
---|---|
With sodium sulfide; sodium hydroxide anschliessendes Behandeln mit Jod und KI; |
tert.-butylhydroperoxide
5-thio-2-nitrobenzoic acid
A
5,5'-dithiobis-(2-nitrobenzoic acid)
B
tert-butyl alcohol
Conditions | Yield |
---|---|
With ethylenediaminetetraacetic acid; MES buffer; selenosubtilisin (ESeSAr form) at 25℃; Rate constant; pH 5.5; other seleno- reagent, (Km)t-BuOOH; |
5-thio-2-nitrobenzoic acid
5,5'-dithiobis-(2-nitrobenzoic acid)
Conditions | Yield |
---|---|
With potassium hydroxide; dihydrogen peroxide In water | |
With dithionite(2-); cetyltrimethylammonim bromide In water Equilibrium constant; | |
With NaOH buffer; 1-phenylethyl hydroperoxide; seleno-subtilisin Carlsberg; citric acid at 20℃; pH=5.5; Enzyme kinetics; Oxidation; |
3-carboxylate-4-nitrothiophenoxide ion
5,5'-dithiobis-(2-nitrobenzoic acid)
Conditions | Yield |
---|---|
With 1-oxido-1,2-benziodoxol-3(1H)-one In water at 25℃; Kinetics; Rate constant; Mechanism; pH=8, μ=00.1(KCl), the reagent and the title compound were microencapsulated in vesicles of dioctadecyldimethylammonium chloride; |
Cumene hydroperoxide
5-thio-2-nitrobenzoic acid
A
5,5'-dithiobis-(2-nitrobenzoic acid)
B
1-methyl-1-phenylethyl alcohol
Conditions | Yield |
---|---|
Stage #1: 5-thio-2-nitrobenzoic acid With supramolecular artificial glutathione peroxidase (SGPxmax) In aq. phosphate buffer at 36℃; for 0.05h; pH=7; Enzymatic reaction; Stage #2: Cumene hydroperoxide In aq. phosphate buffer Kinetics; Catalytic behavior; Reagent/catalyst; | |
With C17H28O3Te In aq. phosphate buffer; ethanol at 25℃; pH=7; Kinetics; Solvent; |
A
5,5'-dithiobis-(2-nitrobenzoic acid)
B
bis(11-hydroxyundecyl) diselenide
Conditions | Yield |
---|---|
Irradiation; |
Conditions | Yield |
---|---|
Multi-step reaction with 3 steps 1: nitric acid; sulfuric acid / 2 h / 45 - 55 °C 2: potassium permanganate / water / 50 °C 3: sodium sulfide / water / 2 h / 50 °C / pH > 3.5 View Scheme |
5,5'-dithiobis-(2-nitrobenzoic acid)
Conditions | Yield |
---|---|
Stage #1: MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide With D,L-dithiothreitol In aq. phosphate buffer at 37℃; for 0.333333h; pH=7.4; Stage #2: 5,5'-dithiobis-(2-nitrobenzoic acid) In aq. phosphate buffer at 20℃; for 0.0333333h; pH=7.4; | 100% |
5,5'-dithiobis-(2-nitrobenzoic acid)
5-thio-2-nitrobenzoic acid
Conditions | Yield |
---|---|
With sodium tetrahydroborate In ethanol; water at 0 - 20℃; | 97% |
With dithionite(2-); cetyltrimethylammonim bromide In water Kinetics; Equilibrium constant; further reagents, catalysts; | |
With 2-(N,N-dimethylamino)ethanol; 2-mercaptoethylamine hydrochloride In water at 25℃; for 1h; Yield given; |
1-hydroxy-pyrrolidine-2,5-dione
5,5'-dithiobis-(2-nitrobenzoic acid)
5,5'-dithiobis(2-nitrobenzoic acid succinimidyl diester)
Conditions | Yield |
---|---|
With dicyclohexyl-carbodiimide In tetrahydrofuran at 25 - 28℃; for 2h; | 97% |
With dicyclohexyl-carbodiimide In dichloromethane; N,N-dimethyl-formamide at 4℃; | |
With dicyclohexyl-carbodiimide In tetrahydrofuran at 25℃; for 12h; |
5,5'-dithiobis-(2-nitrobenzoic acid)
methyl 2-(2-methoxycarbonyl-3-nitrophenyl)disulfanyl-6-nitrobenzoate
Conditions | Yield |
---|---|
With pyridine; thionyl chloride; citric acid In methanol; dichloromethane; N,N-dimethyl-formamide | 92% |
Conditions | Yield |
---|---|
With potassium carbonate In N,N-dimethyl-formamide at 90 - 95℃; for 5h; Substitution; | 86% |
5,5'-dithiobis-(2-nitrobenzoic acid)
[Na(18-crown-6)][Fe(SC6H3(NO2)COOH)2(NO)2]
Conditions | Yield |
---|---|
In acetonitrile byproducts: S8; (N2); stirring soln. of iron compd. and disulfide deriv. in CH3CN at room temp. for 30 min; evapn., dissolving in THF/diethyl ether (1:1), filtration through celite, addn. of hexane, isolation of ppt., elem. anal.; | 85% |
5,5'-dithiobis-(2-nitrobenzoic acid)
A
2-nitro-5-mercaptobenzyl alcohol
B
5-(methylthio)-2-nitrobenzyl alcohol
Conditions | Yield |
---|---|
With dimethylsulfide borane complex In 1,2-dimethoxyethane for 3h; Heating; | A 80% B n/a |
Conditions | Yield |
---|---|
In ethanol Ambient temperature; | 75% |
Conditions | Yield |
---|---|
Stage #1: 5,5'-dithiobis-(2-nitrobenzoic acid) With sodium hydride In N,N-dimethyl-formamide; mineral oil at 60℃; for 0.25h; Inert atmosphere; Stage #2: 1-Bromo-11-hydroxyundecane In N,N-dimethyl-formamide; mineral oil at 60℃; Inert atmosphere; | 75% |
Conditions | Yield |
---|---|
In ethanol; acetonitrile at 20℃; | 75% |
1,2,3-Benzotriazole
5,5'-dithiobis-(2-nitrobenzoic acid)
{5-[3-(benzotriazole-1-carbonyl)-4-nitrophenyldisulfanyl]-2-nitrophenyl}benzotriazol-1-ylmethanone
Conditions | Yield |
---|---|
Stage #1: 1,2,3-Benzotriazole With thionyl chloride In dichloromethane at 25℃; for 0.5h; Stage #2: 5,5'-dithiobis-(2-nitrobenzoic acid) In dichloromethane | 74% |
5,5'-dithiobis-(2-nitrobenzoic acid)
Conditions | Yield |
---|---|
2-(N,N-dimethylamino)ethanol | 70% |
5,5'-dithiobis-(2-nitrobenzoic acid)
1,8-diazabicyclo[5.4.0]undec-7-ene
C9H16N2*C14H8N2O8S2
Conditions | Yield |
---|---|
In chloroform | 68% |
5,5'-dithiobis-(2-nitrobenzoic acid)
Conditions | Yield |
---|---|
With trimethylamine In dichloromethane for 1h; | 63% |
1,2-bis(4'-pyridyl)ethane
5,5'-dithiobis-(2-nitrobenzoic acid)
water
manganese (II) acetate tetrahydrate
Conditions | Yield |
---|---|
With sodium hydroxide In ethanol at 130℃; for 144h; pH=7; High pressure; | 60% |
5,5'-dithiobis-(2-nitrobenzoic acid)
(4E,8E,12E,16E)-4,8,13,17,21-pentamethyl-4,8,12,16,20-docosapentaen-1-thiol
Conditions | Yield |
---|---|
In ethanol Ambient temperature; | 57% |
methanol
5,5'-dithiobis-(2-nitrobenzoic acid)
methyl 2-(2-methoxycarbonyl-3-nitrophenyl)disulfanyl-6-nitrobenzoate
Conditions | Yield |
---|---|
With sulfuric acid Reflux; | 57% |
With thionyl chloride at 0℃; for 19h; Reflux; | 55% |
With dmap; dicyclohexyl-carbodiimide In dichloromethane at 20℃; for 20h; Inert atmosphere; |
1,10-Phenanthroline
5,5'-dithiobis-(2-nitrobenzoic acid)
manganese (II) acetate tetrahydrate
Conditions | Yield |
---|---|
With sodium hydroxide In ethanol; water at 130℃; for 144h; pH=7; High pressure; | 56% |
5,5'-dithiobis-(2-nitrobenzoic acid)
water
manganese (II) acetate tetrahydrate
trans-1,2-bis(4-pyridyl)ethylene
Conditions | Yield |
---|---|
With sodium hydroxide In ethanol at 130℃; for 144h; pH=7; High pressure; | 55% |
5,5'-dithiobis-(2-nitrobenzoic acid)
thiocholesterol
5-[(thiocholesteryl)thio]-2-nitrobenzoic acid
Conditions | Yield |
---|---|
With triethylamine In tetrahydrofuran at 20℃; for 14h; | 51% |
5,5'-dithiobis-(2-nitrobenzoic acid)
2-mercaptoethylamine hydrochloride
S-<(3-carboxy-4-nitrophenyl)thio>-2-aminoethanethiol
Conditions | Yield |
---|---|
With sodium hydroxide In water at 20℃; for 2h; pH=7; | 50% |
With sodium hydroxide for 1h; Yield given; |
5,5'-dithiobis-(2-nitrobenzoic acid)
cucurbituril
Conditions | Yield |
---|---|
With water; ammonium chloride at 120℃; for 6h; Time; Temperature; Autoclave; | 50% |
Octadecanethiol
5,5'-dithiobis-(2-nitrobenzoic acid)
5-(Octadecyldithio)-2-nitrobenzoic acid
Conditions | Yield |
---|---|
With triethylamine In chloroform for 5h; | 47% |
Conditions | Yield |
---|---|
In ethanol; water; acetonitrile at 20℃; | 41% |
3-mercaptopropionitrile
5,5'-dithiobis-(2-nitrobenzoic acid)
5-(2-cyanoethyldithio)-2-nitrobenzoic acid
Conditions | Yield |
---|---|
With phosphate buffer for 0.5h; Ambient temperature; | 40% |
5,5'-dithiobis-(2-nitrobenzoic acid)
Cysteamine
S-<(3-carboxy-4-nitrophenyl)thio>-2-aminoethanethiol
Conditions | Yield |
---|---|
In water; acetonitrile for 14h; Ambient temperature; | 40% |
In water; acetonitrile | 40% |
5,5'-dithiobis-(2-nitrobenzoic acid)
cucurbituril
Conditions | Yield |
---|---|
With BaCl2*10H2O In water at 120℃; for 6h; Autoclave; | 40% |
5,5'-dithiobis-(2-nitrobenzoic acid)
3-hydroxy-3,4-dihydrobenzotriazine-4-one
bis{3-O-[N-1,2,3-benzotriazin-4(3H)-one]-yl}-5,5'-dithiobis-2-nitrobenzoate
Conditions | Yield |
---|---|
With dicyclohexyl-carbodiimide In dichloromethane at 20℃; for 12h; | 31% |
With dicyclohexyl-carbodiimide In dichloromethane at 20℃; for 12h; Etherification; | 31% |
Conditions | Yield |
---|---|
In 2-methyl-propan-1-ol at 85℃; Sealed tube; High pressure; | 30% |
About|Contact|Cas|Product Name|Molecular|Country|Encyclopedia
Message|New Cas|MSDS|Service|Advertisement|CAS DataBase|Article Data|Manufacturers | Chemical Catalog
©2008 LookChem.com,License: ICP
NO.:Zhejiang16009103
complaints:service@lookchem.com Desktop View